PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G05890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 1096aa    MW: 119527 Da    PI: 4.6768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G05890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45.2e-11593638247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        WTteE+ +++++ + +G g Wk+I+  +   +t+ q+ s+ qky
  OMERI06G05890.1 593 RFWTTEEHRQFLRGLRVYGRGEWKSISMNFVRSKTPVQVSSHAQKY 638
                      56*****************************9*************9 PP

2Myb_DNA-binding391.9e-129881034147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       r  WT+eE+ l+  + + +G g+Wk I++++ ++Rt+ q+ s+ qk+
  OMERI06G05890.1  988 RVVWTEEEHRLFMVGLRVFGRGDWKNISKHLVTTRTAAQVSSHAQKF 1034
                       678******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071785572IPR001005SANT/Myb domain
PROSITE profilePS512939.076192245IPR017884SANT domain
SMARTSM007172.0E-4193243IPR001005SANT/Myb domain
SuperFamilySSF466892.01E-9197243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-5197234IPR009057Homeodomain-like
CDDcd001678.07E-5197241No hitNo description
PROSITE profilePS5129413.601587643IPR017930Myb domain
SuperFamilySSF466891.29E-14589644IPR009057Homeodomain-like
SMARTSM007171.4E-9591641IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.0E-13592641IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-8592640IPR009057Homeodomain-like
PfamPF002491.0E-7595638IPR001005SANT/Myb domain
CDDcd001671.09E-7595639No hitNo description
PROSITE profilePS5129414.5799831039IPR017930Myb domain
SuperFamilySSF466893.59E-169851039IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-89861033IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-149861037IPR006447Myb domain, plants
SMARTSM007172.3E-99871037IPR001005SANT/Myb domain
PfamPF002491.8E-99881033IPR001005SANT/Myb domain
CDDcd001676.02E-89911035No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1096 aa     Download sequence    Send to blast
MDEGFGMEWT AAELAEARSV IARVSNAYDS GAGSSNSAGD TKHDRIMREL QARFPSRTMV  60
QVIDLCLNLT AETAAQAGAA QPQDAGVGSS SSAGDTKPDR IMRELQARFP SRTMVQVIDL  120
YVNLTVETAA QPQHASATGA AVVVDNFGMP VANNNDGVDA GMVLGGAAME EGAVAVAVNG  180
GDGEVVNQDD ADDDVLWTDY EHRLFLTGMR VYGRGEWRNI SRYFVRSKTP EQISIYADNY  240
FHMMEIAAAM EADGDDDDGH HENNNNNNNN LGGGQLHAVV GAVGHGPGAG HIAPTTSSNN  300
NVAATAANNN VDAPFWVPLL YNPEIEQRMM EMQAQSQKAW DDQQMKMAEA ATPKEEGAAD  360
KFGGMEWTAA EMDEARSIVV RLANAYDSSA AVVVASAGNG DTRHDRIWTA AEMDEARSIV  420
ARLTNAYDSG ALVAGAGNGD TRHDRIVRDL QAWFPWRTMD QLIGLYIELM AEEPAVAQPQ  480
YFDAGAVVDP TFDFFNDHNN FLGMPPPPPV QQADDHAMNN VVADAGMNYY YGGGGGGAMV  540
FGGAPMGETV EQAAPPAPAP VPVAPVVMNR DDDEVNNQGG GRHRAAPTNT TRRFWTTEEH  600
RQFLRGLRVY GRGEWKSISM NFVRSKTPVQ VSSHAQKYFR RVESAAADKQ RYSINDVGLN  660
DDDEDDDDAM DGTNSYSNNN FNNNFGGWQS LAFAGGHLEP VSGGGAAGQV IAPASSSAAV  720
MNSAAQFWAP MLYNPQIQQQ FMQMQAQTQQ AWNDQHMMMA AAPMEGATDN NFEPAGAANY  780
YYQQQQEEEE GGAYGVPADQ WMMNQNNNIA PVTSFIVIEG WTASEIEEAR SLITSPNNGC  840
EGGDGEGNKQ KHCGRIVMEL HEWFPWKTIG QVIGLYMKLN AGKPMVMHSL NKSDANNSIG  900
EVDHVSALAN GNPVRLEEHR PMLNNVGLLF DYPLEEIEME NQTDQEPKMV VEEEEVQPKE  960
GLVIKEKEVG VSNIHTNSRH VTPSIKRRVV WTEEEHRLFM VGLRVFGRGD WKNISKHLVT  1020
TRTAAQVSSH AQKFFLKMEA RGEAIPPPAK RRRRRFTGDQ QQTAAPPSTP PPSGAACQCH  1080
HHLRSTPSSC PASSRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
110491054KRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642794.10.0PREDICTED: uncharacterized protein LOC107281372
TrEMBLA0A0E0DXS90.0A0A0E0DXS9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA021812-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g07650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1419033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.23e-19MYB family protein